Syntrophin alpha 1 Antibody (3B10G10)

Novus Biologicals | Catalog # NBP3-15899

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3B10G10 expressed in HEK293
View all Syntrophin alpha 1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntrophin alpha 1 (Q13424). MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEPGAGPPQLPEALLLQRRRVTVRKADAGGLGI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Syntrophin alpha 1 Antibody (3B10G10)

Western Blot: Syntrophin alpha 1 Antibody (3B10G10) [NBP3-15899]

Western Blot: Syntrophin alpha 1 Antibody (3B10G10) [NBP3-15899]

Western Blot: Syntrophin alpha 1 Antibody (3B10G10) [NBP3-15899] - Western blot analysis of extracts of various cell lines, using Syntrophin alpha 1 Rabbit mAb (NBP3-15899) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Syntrophin alpha 1 Antibody (3B10G10) [NBP3-15899]

Western Blot: Syntrophin alpha 1 Antibody (3B10G10) [NBP3-15899]

Western Blot: Syntrophin alpha 1 Antibody (3B10G10) [NBP3-15899] - Western blot analysis of extracts of Mouse kidney, using Syntrophin alpha 1 Rabbit mAb (NBP3-15899) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

Applications for Syntrophin alpha 1 Antibody (3B10G10)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Syntrophin alpha 1

Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.

Alternate Names

59 kDa dystrophin-associated protein A1 acidic component 1, dJ1187J4.5, LQT12, Pro-TGF-alpha cytoplasmic domain-interacting protein 1, SNT1alpha-1-syntrophin, syntrophin, alpha 1 (dystrophin-associated protein A1, 59kD, acidic component), syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component), syntrophin-1, TACIP1acidic alpha 1 syntrophin

Gene Symbol

SNTA1

Additional Syntrophin alpha 1 Products

Product Documents for Syntrophin alpha 1 Antibody (3B10G10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Syntrophin alpha 1 Antibody (3B10G10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Syntrophin alpha 1 Antibody (3B10G10)

There are currently no reviews for this product. Be the first to review Syntrophin alpha 1 Antibody (3B10G10) and earn rewards!

Have you used Syntrophin alpha 1 Antibody (3B10G10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies