SYPL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88397

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SYPL1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of SYPL1. Peptide sequence: MGSLNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSAPHSQGGIPPPT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SYPL1 Antibody - BSA Free

Western Blot: SYPL1 Antibody [NBP2-88397]

Western Blot: SYPL1 Antibody [NBP2-88397]

Western Blot: SYPL1 Antibody [NBP2-88397] - WB Suggested Anti-SYPL1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Thymus

Applications for SYPL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SYPL1

SYPL1 is a gene that codes for a protein that has two isoforms, with lengths of 259 and 241 amino acids and weights of approximately 29 and 26 kDa respectively. Current research is being done on diseases and disorders related to this gene including neruonitis and alcoholism. SYPL1 has also been shown to have interactions with VAMP2.

Alternate Names

H-SP1, pantophysin, synaptophysin-like 1, synaptophysin-like protein, synaptophysin-like protein 1, SYPL

Gene Symbol

SYPL1

Additional SYPL1 Products

Product Documents for SYPL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SYPL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SYPL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SYPL1 Antibody - BSA Free and earn rewards!

Have you used SYPL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies