TAF1D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85868

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TAF1D Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TAF1D. Peptide sequence: FEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TAF1D Antibody - BSA Free

Western Blot: TAF1D Antibody [NBP2-85868]

Western Blot: TAF1D Antibody [NBP2-85868]

Western Blot: TAF1D Antibody [NBP2-85868] - Host: Rabbit. Target Name: TAF1D. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for TAF1D Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF1D

TAF1D is a member of the SL1 complex, which includes TBP (MIM 600075) and TAF1A (MIM 604903), TAF1B (MIM 604904), andTAF1C (MIM 604905), and plays a role in RNA polymerase I transcription (Wang et al., 2004 (PubMed 15520167); Gorski etal., 2007 (PubMed 17318177)).(supplied by OMIM)

Alternate Names

JOSD3RNA polymerase I-specific TBP-associated factor 41 kDa, Josephin domain containing 3, MGC5306, RAFI41, TAF(I)41, TAFI41, TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa, TATA box-binding protein-associated factor 1D, TATA box-binding protein-associated factor RNA polymerase I subunit D, TBP-associated factor 1D, Transcription initiation factor SL1/TIF-IB subunit D

Gene Symbol

TAF1D

Additional TAF1D Products

Product Documents for TAF1D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF1D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF1D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF1D Antibody - BSA Free and earn rewards!

Have you used TAF1D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies