TAF9b Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88404

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAF9b. Peptide sequence: TAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TAF9b Antibody - BSA Free

Western Blot: TAF9b Antibody [NBP2-88404]

Western Blot: TAF9b Antibody [NBP2-88404]

Western Blot: TAF9b Antibody [NBP2-88404] - Host: Rabbit. Target Name: TAF9B. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Applications for TAF9b Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF9b

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein thatcoordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position thepolymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as achannel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarilyconserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve ascoactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complexassembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits ofTFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also havedistinct roles in the transcriptional regulatory process. (provided by RefSeq)

Alternate Names

31kDa, DN7, DN-7Transcription-associated factor TAFII31L, Neuronal cell death-related protein 7, TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF9-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF9Ltranscription associated factor TAFII31L, TAFII31LTBP-associated factor 9L, TFIID-31, transcription initiation factor IID, 31kD subunit, transcription initiation factor TFIID subunit 9B, Transcription initiation factor TFIID subunit 9-like

Gene Symbol

TAF9B

Additional TAF9b Products

Product Documents for TAF9b Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF9b Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF9b Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF9b Antibody - BSA Free and earn rewards!

Have you used TAF9b Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...