TARSL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83616

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TARSL2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TARSL2. Peptide sequence: TYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TARSL2 Antibody - BSA Free

Western Blot: TARSL2 Antibody [NBP2-83616]

Western Blot: TARSL2 Antibody [NBP2-83616]

Western Blot: TARSL2 Antibody [NBP2-83616] - Host: Rabbit. Target Name: TARSL2. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for TARSL2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TARSL2

TARSL2 is a gene that codes for a protein that is 802 amino acids long, weighs approximately 93 kDa, and has a shorter isoform that is 707 amino acids long and weighs approximately 82 kDa. Current studies are being done on diseases and disorders linked to this gene including pneumonia, tuberculosis, and malaria. TARSL2 has also been shown to have interactions with PRKAB1, C12orf44, DDA1, GBAS, and TRAF6 in pathways such as the aminoacly-tRNA biosynthesis pathway.

Alternate Names

probable threonine--tRNA ligase 2, cytoplasmic, threonyl-tRNA synthetase-like 2

Gene Symbol

TARS3

Additional TARSL2 Products

Product Documents for TARSL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TARSL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TARSL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TARSL2 Antibody - BSA Free and earn rewards!

Have you used TARSL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies