TATA Element Modulatory Factor 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79708

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TATA Element Modulatory Factor 1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human TMF1. Peptide sequence TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

123 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TATA Element Modulatory Factor 1 Antibody - BSA Free

Western Blot: TATA Element Modulatory Factor 1 Antibody [NBP1-79708]

Western Blot: TATA Element Modulatory Factor 1 Antibody [NBP1-79708]

Western Blot: TATA Element Modulatory Factor 1 Antibody [NBP1-79708] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for TATA Element Modulatory Factor 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TATA Element Modulatory Factor 1

Potential coactivator of the androgen receptor. Mediates STAT3 degradation. May play critical roles in two RAB6-dependent retrograde transport processes: one from endosomes to the Golgi and the other from the Golgi to the ER. This protein binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP)

Alternate Names

TATA element modulatory factor 1

Gene Symbol

TMF1

UniProt

NP_009045 (Human)

Additional TATA Element Modulatory Factor 1 Products

Product Documents for TATA Element Modulatory Factor 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TATA Element Modulatory Factor 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TATA Element Modulatory Factor 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TATA Element Modulatory Factor 1 Antibody - BSA Free and earn rewards!

Have you used TATA Element Modulatory Factor 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies