Tau tubulin kinase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82388

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Tau tubulin kinase 2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide towards tau tubulin kinase 2. Peptide sequence KPDYQLLTSVFDNSIKTFGVIESDPFDWEKSGTDGSLTTTTTSATPQLHT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

137 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tau tubulin kinase 2 Antibody - BSA Free

Western Blot: Tau tubulin kinase 2 Antibody [NBP1-82388]

Western Blot: Tau tubulin kinase 2 Antibody [NBP1-82388]

Western Blot: Tau tubulin kinase 2 Antibody [NBP1-82388] - Mouse Thymus Lysate 1ug/ml Gel Concentration 6-18%

Applications for Tau tubulin kinase 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tau tubulin kinase 2

The Tau tubulin kinase 2 gene encodes a serine-threonine kinase that putatively phosphorylates tau and tubulin proteins. Mutations in thisgene cause spinocerebellar ataxia type 11 (SCA11); a neurodegenerative disease characterized by progressive ataxia andatrophy of the cere

Alternate Names

EC 2.7.11, EC 2.7.11.1, KIAA0847tau-tubulin kinase 2, SCA11, spinocerebellar ataxia 11, tau tubulin kinase 2, TTBK

Gene Symbol

TTBK2

UniProt

NP_001020027 (Mouse)

Additional Tau tubulin kinase 2 Products

Product Documents for Tau tubulin kinase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tau tubulin kinase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tau tubulin kinase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tau tubulin kinase 2 Antibody - BSA Free and earn rewards!

Have you used Tau tubulin kinase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies