TBC1D3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86844

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBC1D3. Peptide sequence: NRFVDTWARDEDTVLKHLRASMKKLTRKQGDLPPPAKPEQGSSASRPVPA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TBC1D3 Antibody - BSA Free

Western Blot: TBC1D3 Antibody [NBP2-86844]

Western Blot: TBC1D3 Antibody [NBP2-86844]

Western Blot: TBC1D3 Antibody [NBP2-86844] - Host: Rabbit. Target Name: TBC1D3. Sample Type: Human Jurkat. Antibody Dilution: 1.0ug/mlTBC1D3 is supported by BioGPS gene expression data to be expressed in Jurkat
Western Blot: TBC1D3 Antibody [NBP2-86844]

Western Blot: TBC1D3 Antibody [NBP2-86844]

Western Blot: TBC1D3 Antibody [NBP2-86844] - WB Suggested Anti-TBC1D3 Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole Cell
Western Blot: TBC1D3 Antibody [NBP2-86844]

Western Blot: TBC1D3 Antibody [NBP2-86844]

Western Blot: TBC1D3 Antibody [NBP2-86844] - Host: Rabbit. Target Name: TBC1D3. Sample Type: Human 293T. Antibody Dilution: 1.0ug/mlTBC1D3 is supported by BioGPS gene expression data to be expressed in HEK293T

Applications for TBC1D3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TBC1D3

Predicted to enable GTPase activator activity. Predicted to be involved in activation of GTPase activity and intracellular protein transport. Predicted to be located in early endosome membrane.

Alternate Names

PRC17, prostate cancer gene 17 protein, protein TRE17-alpha, Rab GTPase-Activating Protein PRC17, TBC1 domain family member 3, TBC1 Domain Family Member 3C, TBC1 domain family member 3L, TBC1D3A, TBC1D3C, TBC1D3D, TBC1D3F, TBC1D3L

Gene Symbol

TBC1D3

Additional TBC1D3 Products

Product Documents for TBC1D3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TBC1D3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TBC1D3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TBC1D3 Antibody - BSA Free and earn rewards!

Have you used TBC1D3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...