TBK1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-55777PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBK1.

Source: E. coli

Amino Acid Sequence: TATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55777.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-55777PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TBK1

NFkappaB-activating kinase (NAK) also known as TANK binding kinase-1 (TBK1) or tumor necrosis factor receptor associated factor 2-associated kinase (T2K) is a serine/threonine protein that belongs to the IkB kinase (IKK) family (1). Similar to IKK alpha and beta (2), NAK induces IkB degradation and NF-kB activity. NAK is activated by phorbol ester tumour promoters and growth factors, whereas catalytically inactive NAK specifically inhibits activation of NF-kB by protein kinase C-epsilon (PKCepsilon). NAK specifically phosphorylates IkB alpha on Serine 36 and NFkB subunit RelA (p65) on Serine 536 (3). NAK is also known to interact with TANK, TRAF-2 and TRIF (4).

Long Name

TANK Binding Kinase 1

Alternate Names

FTDALS4, NAK, NFKB-Activating Kinase

Gene Symbol

TBK1

Additional TBK1 Products

Product Documents for TBK1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TBK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for TBK1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review TBK1 Recombinant Protein Antigen and earn rewards!

Have you used TBK1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for TBK1 Recombinant Protein Antigen

Showing  1 - 5 of 6 FAQs Showing All
  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

  • Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?

    A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301

  • Q: Cant this TBK1 antibody be conjugated to PE for FLOW?

    A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

  • Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?

    A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.

  • Q: Is there a smaller size of your TBK1 antibody?

    A: This TBK1 antibody is offered in a smaller 0.025 mg size.

  • Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?

    A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.

  • Q: What is the exact sequence this TBK1 antibody recognizes?

    A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.

Showing  1 - 5 of 6 FAQs Showing All
View all FAQs for Proteins and Enzymes
Loading...