TBL1Y Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79459

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TBL1Y Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human TBL1Y. Peptide sequence LASGSFDKYVHIWNTQSGSLVHSYQGTGGIFEVCWNARGDKVGASASDGS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TBL1Y Antibody - BSA Free

Western Blot: TBL1Y Antibody [NBP1-79459]

Western Blot: TBL1Y Antibody [NBP1-79459]

Western Blot: TBL1Y Antibody [NBP1-79459] - TBL1Y Antibody Human Lung lysate, concentration 0.2-1 ug/ml.

Applications for TBL1Y Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TBL1Y

TBL1Y has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This gene is highly similar to TBL1X gene in nucleotide sequence and protein sequence, but the TBL1X gene is located on chromosome X and this gene is on chromosome Y. This gene has three alternatively spliced transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Alternate Names

F-box-like/WD repeat-containing protein TBL1Y, TBL1, TBL1Y transducin (beta)-like 1, Y-linked, transducin beta-like 1, transducin beta-like protein 1Y, transducin-beta-like protein 1, Y-linked

Gene Symbol

TBL1Y

UniProt

NP_150600 (Human)

Additional TBL1Y Products

Product Documents for TBL1Y Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TBL1Y Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TBL1Y Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TBL1Y Antibody - BSA Free and earn rewards!

Have you used TBL1Y Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies