TBX4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85889

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TBX4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TBX4. Peptide sequence: LRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQALQHYQHE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TBX4 Antibody - BSA Free

Western Blot: TBX4 Antibody [NBP2-85889]

Western Blot: TBX4 Antibody [NBP2-85889]

Western Blot: TBX4 Antibody [NBP2-85889] - WB Suggested Anti-TBX4 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Western Blot: TBX4 Antibody [NBP2-85889]

Western Blot: TBX4 Antibody [NBP2-85889]

Western Blot: TBX4 Antibody [NBP2-85889] - Host: Rabbit. Target: TBX4. Positive control (+): Human lung (LU). Negative control (-): MCF7 (N10). Antibody concentration: 1ug/ml
Western Blot: TBX4 Antibody [NBP2-85889]

Western Blot: TBX4 Antibody [NBP2-85889]

Western Blot: TBX4 Antibody [NBP2-85889] - Host: Rabbit. Target Name: TBX4. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 2ug/ml

Applications for TBX4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TBX4

The TBX4 gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human homolog of mous

Alternate Names

SPS, T-box 4, T-box protein 4, T-box transcription factor TBX4

Gene Symbol

TBX4

Additional TBX4 Products

Product Documents for TBX4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TBX4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TBX4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TBX4 Antibody - BSA Free and earn rewards!

Have you used TBX4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies