TDRD9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84297

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TDRD9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TDRD9. Peptide sequence: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TDRD9 Antibody - BSA Free

Western Blot: TDRD9 Antibody [NBP2-84297]

Western Blot: TDRD9 Antibody [NBP2-84297]

Western Blot: TDRD9 Antibody [NBP2-84297] - Host: Rabbit. Target Name: TDRD9. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for TDRD9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TDRD9

TDRD9, also referred to as Tudor Domain Containing 9, is a member of the DEAD box helicase family. TDRD9 is thought to be an ATP-binding RNA helicase that plays an important role in spermatogenesis. TDRD9 has also been shown to interact with PIWIL1 and PIWIL4 via the piRNA metabolic pathway. Current research surrounding TDRD9 has shown a possible link with diseases and disorders such as bipolar disorder, hypoxia, and malaria.

Alternate Names

C14orf75, chromosome 14 open reading frame 75, DKFZp434N0820, EC 3.6.1, EC 3.6.4.13, FLJ36164, HIG-1, hypoxia-inducible HIG-1, MGC135025, NET54, putative ATP-dependent RNA helicase TDRD9, tudor domain containing 9, Tudor domain-containing protein 9

Gene Symbol

TDRD9

Additional TDRD9 Products

Product Documents for TDRD9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TDRD9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TDRD9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TDRD9 Antibody - BSA Free and earn rewards!

Have you used TDRD9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies