TEAD4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82386

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TEAD4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide towards Tead4. Peptide sequence RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TEAD4 Antibody - BSA Free

Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386] - Antibody Titration: 1 ug/ml Human liver.
Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386] - Mouse Intestine Lysate 1.0 ug/ml, gel comcentration 12%
Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386] - Antibody Titration: 1 ug/ml Human heart.

Applications for TEAD4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TEAD4

TEAD4 product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Alternate Names

EFTR-2, hRTEF-1B, related transcription enhancer factor 1B, RTEF1RTEF-1, TCF13L1MGC9014, TEA domain family member 4TEF3, TEAD-4, TEF-3, TEFR-1, Transcription factor 13-like 1, Transcription factor RTEF-1, transcriptional enhancer factor 1-related, transcriptional enhancer factor 3, transcriptional enhancer factor TEF-3

Gene Symbol

TEAD4

UniProt

NP_035697 (Mouse)

Additional TEAD4 Products

Product Documents for TEAD4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TEAD4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TEAD4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TEAD4 Antibody - BSA Free and earn rewards!

Have you used TEAD4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies