TERT Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56116

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TERT Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TERT Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TERT Antibody [NBP2-56116]

Immunocytochemistry/ Immunofluorescence: TERT Antibody [NBP2-56116]

Immunocytochemistry/Immunofluorescence: TERT Antibody [NBP2-56116] - Staining of human cell line LHCN-M2 shows localization to nucleus & nuclear speckles. Antibody staining is shown in green.
TERT Antibody - BSA Free Chromatin Immunoprecipitation ChIP: TERT Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: TERT Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-TERT tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for TERT Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TERT

Telomeres are nucleoprotein structures at the ends of eukaryotic chromosomes. Telomeres regulate several crucial cellular functions and participate in the control of complex phenotypes, such as aging and cancer. Cell immortalization is strongly associated with the stabilization of telomere length. Therefore, it is suggested that cancer cells achieve immortalization in part through illegitimate activation of telomerase expression. Telomerase reverse transcriptase (TERT) is the rate-limiting catalytic subunit of telomerase. Telomerase is a ribonucleoprotein composed of an internal telomerase RNA template (TERC) and the enzyme TERT. Telomerase is an enzyme uniquely associated with immortal cell lines and is useful for identifying undifferentiated PSCs.

Long Name

Telomerase Reverse Transcriptase

Alternate Names

EST2Telomerase-associated protein 2, hEST2, hTERT, TCS1EC 2.7.7.49, Telomerase catalytic subunit, telomerase reverse transcriptase, TP2HEST2, TRTEC 2.7.7

Gene Symbol

TERT

Additional TERT Products

Product Documents for TERT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TERT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Intestinal Stem Cell Markers

Customer Reviews for TERT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TERT Antibody - BSA Free and earn rewards!

Have you used TERT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies