Testin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88429

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Testin Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Testin. Peptide sequence: PKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Testin Antibody - BSA Free

Western Blot: Testin Antibody [NBP2-88429]

Western Blot: Testin Antibody [NBP2-88429]

Western Blot: Testin Antibody [NBP2-88429] - WB Suggested Anti-TES Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellTES is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
Immunohistochemistry-Paraffin: Testin Antibody [NBP2-88429]

Immunohistochemistry-Paraffin: Testin Antibody [NBP2-88429]

Immunohistochemistry-Paraffin: Testin Antibody [NBP2-88429] - Rabbit Anti-TES Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue. Observed Staining: Cytoplasm in follicular cells.

Applications for Testin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Testin

Cancer-associated chromosomal changes often involve regions containing fragile sites. This gene maps to a commom fragile site on chromosome 7q31.2 designated FRA7G. This gene is similar to mouse Testin, a testosterone-responsive gene encoding a Sertoli cell secretory protein containing three LIM domains. LIM domains are double zinc-finger motifs that mediate protein-protein interactions between transcription factors, cytoskeletal proteins and signaling proteins. Multiple protein isoforms are encoded by transcript variants of this gene.

Alternate Names

DKFZP586B2022, MGC1146, TESS, TESS-2, TESTIN, testis derived transcript (3 LIM domains)

Gene Symbol

TES

Additional Testin Products

Product Documents for Testin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Testin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Testin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Testin Antibody - BSA Free and earn rewards!

Have you used Testin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies