Tex14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54999

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Tex14 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TEX14(testis expressed 14) The peptide sequence was selected from the C terminal of TEX14. Peptide sequence ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

160 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tex14 Antibody - BSA Free

Western Blot: Tex14 Antibody [NBP1-54999]

Western Blot: Tex14 Antibody [NBP1-54999]

Western Blot: Tex14 Antibody [NBP1-54999] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for Tex14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tex14

TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.

Alternate Names

cancer/testis antigen 113, CT113, Protein kinase-like protein SgK307, SGK307, Sugen kinase 307, testis expressed 14, testis expressed sequence 14, testis-expressed protein 14, Testis-expressed sequence 14

Gene Symbol

TEX14

UniProt

Q8IWB6 (Human)

Additional Tex14 Products

Product Documents for Tex14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tex14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tex14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tex14 Antibody - BSA Free and earn rewards!

Have you used Tex14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies