Tex14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09321

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Tex14 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Tex14 (NP_938207). Peptide sequence TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

164 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Tex14 Antibody - BSA Free

Western Blot: Tex14 Antibody [NBP3-09321]

Western Blot: Tex14 Antibody [NBP3-09321]

Western Blot: Tex14 Antibody [NBP3-09321] - Western blot analysis using NBP3-09321 on Human HepG2 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for Tex14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tex14

The Tex14 gene is similar to a mouse gene that is expressed in the testis. [provided by RefSeq]

Alternate Names

cancer/testis antigen 113, CT113, Protein kinase-like protein SgK307, SGK307, Sugen kinase 307, testis expressed 14, testis expressed sequence 14, testis-expressed protein 14, Testis-expressed sequence 14

Gene Symbol

TEX14

Additional Tex14 Products

Product Documents for Tex14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tex14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tex14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tex14 Antibody - BSA Free and earn rewards!

Have you used Tex14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies