TFCP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10892

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TFCP2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TFCP2 (NP_005644). Peptide sequence YSMSDVLALPIFKQEESSLPPDNENKILPFQYVLCAATSPAVKLHDETLT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TFCP2 Antibody - BSA Free

Western Blot: TFCP2 Antibody [NBP3-10892]

Western Blot: TFCP2 Antibody [NBP3-10892]

Western Blot: TFCP2 Antibody [NBP3-10892] - TFCP2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with NBP3-10892 with 1:200 dilution. Western blot was performed using NBP3-10892 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: TFCP2 IP with NBP3-10892 in HEK293

Applications for TFCP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TFCP2

CP2c binds a variety of cellular and viral promoters including fibrinogen, alpha-globin, SV40 and HIV-1 promoters. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with UBP1. Functions as part of the SSP (stage selecto

Alternate Names

alpha-globin transcription factor CP2, CP2, LBP-1C, LSF1D, LSFLBP1C, SAA3 enhancer factor, SEF, TFCP2C, transcription factor CP2, Transcription factor LSF

Gene Symbol

TFCP2

Additional TFCP2 Products

Product Documents for TFCP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TFCP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TFCP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TFCP2 Antibody - BSA Free and earn rewards!

Have you used TFCP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies