TFF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34032

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TFF2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWC

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit TFF2 Antibody - BSA Free (NBP2-34032) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for TFF2 Antibody - BSA Free

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032] - Analysis in human stomach and tonsil tissues using NBP2-34032 antibody. Corresponding TFF2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032] - Staining of human Stomach shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032] - Staining of human Skin shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032]

Immunohistochemistry-Paraffin: TFF2 Antibody [NBP2-34032] - Staining of human Tonsil shows no positivity in non-germinal center cells as expected.

Applications for TFF2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TFF2

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq]

Long Name

Trefoil Factor 2

Alternate Names

SML1, SP, Spasmolysin, Spasmolytic Polypeptide, TFF2

Gene Symbol

TFF2

UniProt

Q03403

Additional TFF2 Products

Product Documents for TFF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TFF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TFF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TFF2 Antibody - BSA Free and earn rewards!

Have you used TFF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies