TFIP11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86861

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TFIP11. Peptide sequence: QKELSQWRKDPSGSKKKPKYSYKTVEELKAKGRISKKLTAPQKELSQVKV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TFIP11 Antibody - BSA Free

Western Blot: TFIP11 Antibody [NBP2-86861]

Western Blot: TFIP11 Antibody [NBP2-86861]

Western Blot: TFIP11 Antibody [NBP2-86861] - Host: Rabbit. Target Name: TFP11. Sample Type: Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for TFIP11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TFIP11

Neurotensin (NT) initiates an intracellular response by interacting with the G protein-coupled receptors NTR1 (NTS1 receptor, high affinity NTR) and NTR2 (NTS2 receptor, levocabastine-sensitive neurotensin receptor), and the type I receptor NTR3 (NTS3 receptor, sortilin-1, Gp95). NT has a wide distribution in regions of the brain and in peripheral tissues where NT receptors can contribute to hypotension, hyperglycemia, hypothermia, antinociception and regulation of intestinal motility and secretion. HL-60 cells express NTR1, which can couple to Gq, Gi/o, or Gs. Alternative splicing of rat NTR2 can generate a 5-transmembrane domain variant isoform that is co-expressed with the full-length NTR2 throughout the brain and spinal cord. NTR3 activation in the murine microglial cell line N11 induces MIP-2, MCP-1, IL-1beta and TNFalpha in an ERK1/2 and Akt kinase-dependent manner.

Alternate Names

bK445C9.6, DKFZP434B194, FLJ22086, hNtr1, NTR1, Septin and tuftelin-interacting protein 1, STIP, STIP-1, TIP39Spp382, tuftelin interacting protein 11, tuftelin-interacting protein 11

Gene Symbol

TFIP11

Additional TFIP11 Products

Product Documents for TFIP11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TFIP11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TFIP11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TFIP11 Antibody - BSA Free and earn rewards!

Have you used TFIP11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...