TfR2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86864

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TfR2. Peptide sequence: RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TfR2 Antibody - BSA Free

Western Blot: TfR2 Antibody [NBP2-86864]

Western Blot: TfR2 Antibody [NBP2-86864]

Western Blot: TfR2 Antibody [NBP2-86864] - WB Suggested Anti-TFR2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle
Immunohistochemistry: TfR2 Antibody [NBP2-86864]

Immunohistochemistry: TfR2 Antibody [NBP2-86864]

Immunohistochemistry: TfR2 Antibody [NBP2-86864] - Human Skin
Western Blot: TfR2 Antibody [NBP2-86864]

Western Blot: TfR2 Antibody [NBP2-86864]

Western Blot: TfR2 Antibody [NBP2-86864] - Host: Rabbit. Target: TFR2. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): 293T Cell Lysate (2T). Antibody concentration: 5ug/ml

Applications for TfR2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TfR2

TFR2 is a gene that codes for a protein with three isoforms, with lengths of 801, 630, and 774 amino acids and weights of approximately 89, 70, and 86 kDa respectively. TFR2 helps in the cellular uptake of transferrin-bound iron as well as iron metabolism, erythrocyte differentiation, and hepatocyte function. Current studies are being done on several diseases and disorders related to this gene including porphyria cutanea tarda, iron overload, beta thalassemia, liver cirrhosis, hepatitis C, fatty liver disease, leukemia, lymphoma, liver disease, and cystic fibrosis. TRF2 has also been shown to have interactions with HFE, TF, UBC, and SOCS3 in pathways such as the AMPK enzyme complex and iron metabolism in the placenta pathways.

Long Name

Transferrin Receptor 2

Alternate Names

HFE3, TFRC2

Gene Symbol

TFR2

Additional TfR2 Products

Product Documents for TfR2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TfR2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for TfR2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TfR2 Antibody - BSA Free and earn rewards!

Have you used TfR2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...