THADA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85907

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all THADA Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human THADA. Peptide sequence: SQVLYKLEQSKSKREPENELTKQHPSVSLQQYKNFMSSICNSLFEALFPG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for THADA Antibody - BSA Free

Western Blot: THADA Antibody [NBP2-85907]

Western Blot: THADA Antibody [NBP2-85907]

Western Blot: THADA Antibody [NBP2-85907] - Host: Rabbit. Target Name: THADA. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for THADA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: THADA

THADA is a gene that codes for a protein that is expressed in many organs including the pancreas, thyroid, and testis, and has five isoforms, with lengths of 1953, 1632, 1897, 674, and 937 amino acids and weights of approximately 220, 183, 211, 76, and 105 kDa respectively. Current research is being done on several diseases and disorders related to this gene including adenoma, thyroiditis, polycystic ovary syndrome, cleft lip/palate, diabetes mellitus, Crohn's disease, prostate cancer, obesity, and prostatitis. THADA has also been shown to have interactions with PRKAA1 and UBC.

Alternate Names

death receptor-interacting protein, FLJ21877, FLJ44016, FLJ44876, gene inducing thyroid adenomas protein, KIAA1767, thyroid adenoma associated, thyroid adenoma-associated protein

Gene Symbol

THADA

Additional THADA Products

Product Documents for THADA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for THADA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for THADA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review THADA Antibody - BSA Free and earn rewards!

Have you used THADA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies