THOC7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85910

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all THOC7 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human THOC7. Peptide sequence: SVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for THOC7 Antibody - BSA Free

Western Blot: THOC7 Antibody [NBP2-85910]

Western Blot: THOC7 Antibody [NBP2-85910]

Western Blot: THOC7 Antibody [NBP2-85910] - Host: Rabbit. Target Name: THOC7. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for THOC7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: THOC7

THOC7 is a component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with splicedmRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Bindsto mRNA upstream of the exon-ju

Alternate Names

FLJ23445, fSAP24NIF3L1-binding protein 1, Functional spliceosome-associated protein 24, Ngg1 interacting factor 3 like 1 binding protein 1, Ngg1-interacting factor 3-like protein 1-binding protein 1, NIF3L1BP1hTREX30, THO complex 7 homolog (Drosophila), THO complex subunit 7 homolog

Gene Symbol

THOC7

Additional THOC7 Products

Product Documents for THOC7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for THOC7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for THOC7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review THOC7 Antibody - BSA Free and earn rewards!

Have you used THOC7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies