Thromboxane synthase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33947

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Thromboxane synthase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Thromboxane synthase Antibody - BSA Free

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947] - Staining of human colon.
Immunohistochemistry: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry: Thromboxane synthase Antibody [NBP2-33947] - Staining of human bone marrow shows moderate cytoplasmic positivity in megakaryocytes.
Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947] - Staining of human skin shows low expression as expected.
Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947] - Staining of human spleen shows high expression.
Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947] - Staining in human spleen and skin tissues using anti-TBXAS1 antibody. Corresponding TBXAS1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947] - Staining of human colon, liver, skin and spleen using Anti-TBXAS1 antibody NBP2-33947 (A) shows similar protein distribution across tissues to independent antibody NBP2-33948 (B).
Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947]

Immunohistochemistry-Paraffin: Thromboxane synthase Antibody [NBP2-33947] - Staining of human liver.

Applications for Thromboxane synthase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Thromboxane synthase

The Thromboxane synthase gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this prot

Alternate Names

CYP5A1family 5, subfamily A, polypeptide 1, CYP5FLJ52771, EC 5.3.99.5, GHOSAL, platelet, cytochrome P450, subfamily V, thromboxane A synthase 1 (platelet), thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A), thromboxane A synthase 1 (platelet, cytochrome P450, subfamily V), thromboxane-A synthase, TXA synthase

Gene Symbol

TBXAS1

UniProt

P24557 (Human)

Additional Thromboxane synthase Products

Product Documents for Thromboxane synthase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Thromboxane synthase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Thromboxane synthase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Thromboxane synthase Antibody - BSA Free and earn rewards!

Have you used Thromboxane synthase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies