TIAL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25192

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TIAL1 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein TIAL1 using the following amino acid sequence: SPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TIAL1 Antibody - BSA Free

TIAL1 Antibody Immunocytochemistry/Immunofluorescence: TIAL1 Antibody [NBP3-25192]

Immunocytochemistry/Immunofluorescence: TIAL1 Antibody [NBP3-25192]

Staining of human cell line HaCaT shows localization to nucleoplasm.

Applications for TIAL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIAL1

TIAL1 is encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing.

Alternate Names

aging-associated gene 7 protein, MGC33401, TCBP, T-cluster binding protein, TIA1 cytotoxic granule-associated RNA binding protein-like 1, TIA1 cytotoxic granule-associated RNA-binding protein-like 1, TIA-1 related protein, TIA-1-related nucleolysin, TIA-1-related protein, TIARnucleolysin TIAR

Gene Symbol

TIAL1

Additional TIAL1 Products

Product Documents for TIAL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TIAL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIAL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIAL1 Antibody - BSA Free and earn rewards!

Have you used TIAL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies