TIGD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70724

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TIGD3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TIGD3(tigger transposable element derived 3) The peptide sequence was selected from the N terminal of TIGD3. Peptide sequence NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TIGD3 Antibody - BSA Free

Western Blot: TIGD3 Antibody [NBP1-70724]

Western Blot: TIGD3 Antibody [NBP1-70724]

Western Blot: TIGD3 Antibody [NBP1-70724] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.

Applications for TIGD3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIGD3

TIGD3 belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of TIGD3 gene is not known.The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.

Alternate Names

tigger transposable element derived 3, tigger transposable element-derived protein 3

Gene Symbol

TIGD3

Additional TIGD3 Products

Product Documents for TIGD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TIGD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIGD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIGD3 Antibody - BSA Free and earn rewards!

Have you used TIGD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies