TIMM13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-74226

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TIMM13 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the N terminal of Timm13. Immunizing peptide sequence FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: Tim13.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TIMM13 Antibody - BSA Free

Western Blot: TIMM13 Antibody [NBP1-74226]

Western Blot: TIMM13 Antibody [NBP1-74226]

Western Blot: TIMM13 Antibody [NBP1-74226] - Mouse Kidney lysate, concentration 1 ug/ml.

Applications for TIMM13 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIMM13

Timm13 is a mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. It is also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. It acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins.

Alternate Names

mitochondrial import inner membrane translocase subunit Tim13, mitochondrial import inner membrane translocase subunit Tim13B, ppv1, Tim13, TIM13B, TIMM13A, TIMM13B, translocase of inner mitochondrial membrane 13 (yeast) homolog B, translocase of inner mitochondrial membrane 13 homolog (yeast)

Gene Symbol

TIMM13

UniProt

P62075 (Mouse)

Additional TIMM13 Products

Product Documents for TIMM13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TIMM13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIMM13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIMM13 Antibody - BSA Free and earn rewards!

Have you used TIMM13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies