TIMM17B Antibody (7N3Z2)

Novus Biologicals | Catalog # NBP3-33481

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 7N3Z2
View all TIMM17B Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 60-160 of human TIMM17B (NP_005825.1).

Sequence:
PQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TIMM17B Antibody (7N3Z2)

TIMM17B Antibody (7N3Z2)

Western Blot: TIMM17B Antibody (7N3Z2) [NBP3-33481] -

Western Blot: TIMM17B Antibody (7N3Z2) [NBP3-33481] - Western Blot analysis of various lysates using TIMM17B Rabbit mAb at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for TIMM17B Antibody (7N3Z2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TIMM17B

The TIMM17B gene encodes a protein that is part of the mitochondrial transport TIMM23 complex. TIM translocase complexes facilitate the transport of mitochondrial proteins from the cytosol across the mitochondrial inner membrane and into the mitochondrion. Two a

Alternate Names

inner mitochondrial membrane preprotein translocase, JM3, mitochondrial import inner membrane translocase subunit Tim17-B, TIM17BDXS9822, translocase of inner mitochondrial membrane 17 homolog B (yeast)

Gene Symbol

TIMM17B

Additional TIMM17B Products

Product Documents for TIMM17B Antibody (7N3Z2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIMM17B Antibody (7N3Z2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIMM17B Antibody (7N3Z2)

There are currently no reviews for this product. Be the first to review TIMM17B Antibody (7N3Z2) and earn rewards!

Have you used TIMM17B Antibody (7N3Z2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies