TIMM22 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-16088

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all TIMM22 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 19-121 of mouse Timm22 (NP_062792.2). AEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIERAMESCAFKAVLACVGGFVLGGAFGIFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TIMM22 Antibody - Azide and BSA Free

Western Blot: TIMM22 AntibodyAzide and BSA Free [NBP3-16088]

Western Blot: TIMM22 AntibodyAzide and BSA Free [NBP3-16088]

Western Blot: TIMM22 Antibody [NBP3-16088] - Western blot analysis of extracts of various cell lines, using TIMM22 antibody (NBP3-16088) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunoprecipitation: TIMM22 Antibody - Azide and BSA Free [NBP3-16088]

Immunoprecipitation: TIMM22 Antibody - Azide and BSA Free [NBP3-16088]

Immunoprecipitation: TIMM22 Antibody [NBP3-16088] - Immunoprecipitation analysis of 600ug extracts of Rat brain cells using 3ug TIMM22 antibody (NBP3-16088). Western blot was performed from the immunoprecipitate using TIMM22 antibody (NBP3-16088) at a dilition of 1:500.

Applications for TIMM22 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunoprecipitation

1:100 - 1:500

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TIMM22

Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps

Alternate Names

mitochondrial import inner membrane translocase subunit Tim22, putative membrane protein, Testis-expressed sequence 4TIM22TEX4, translocase of inner mitochondrial membrane 22 homolog (yeast)

Gene Symbol

TIMM22

Additional TIMM22 Products

Product Documents for TIMM22 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TIMM22 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIMM22 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TIMM22 Antibody - Azide and BSA Free and earn rewards!

Have you used TIMM22 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies