TIMM50 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85918

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TIMM50. Peptide sequence: EDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TIMM50 Antibody - BSA Free

Western Blot: TIMM50 Antibody [NBP2-85918]

Western Blot: TIMM50 Antibody [NBP2-85918]

Western Blot: TIMM50 Antibody [NBP2-85918] - Host: Rabbit. Target Name: TIMM50. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for TIMM50 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIMM50

Tim50 is a component of the yeast Tim23 import machinery, which mediates translocation of presequence containing proteins across the mitochondrial inner membrane. By searching sequence databases, open reading frames encoding proteins with similarity to Tim50 and with a putative mitochondrial presequence were identified in the genomes of evolutionarily distant organisms, including human. Tim50 was found to interact with the N terminal intermembrane space domain of Tim23. Functional defects of Tim50 either by depletion of the protein or addition of anti Tim50 antibodies blocked the protein translocation across the inner membrane. A translocation intermediate accumulated at the translocator of the outer mitochondrial membrane (TOM) complex was cross linked to Tim50. Thus it can be concluded that Tim50, in cooperation with Tim23, facilitates transfer of the translocating protein from the TOM complex to the Tim23 complex.

Alternate Names

homolog of yeast Tim50, MGC102733, mitochondrial import inner membrane translocase subunit TIM50, TIM50, TIM50L, Tim50-like protein, translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae), translocase of inner mitochondrial membrane 50 homolog (yeast)

Gene Symbol

TIMM50

Additional TIMM50 Products

Product Documents for TIMM50 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIMM50 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIMM50 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIMM50 Antibody - BSA Free and earn rewards!

Have you used TIMM50 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...