TIP60 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25195

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein TIP60 using the following amino acid sequence: YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TIP60 Antibody - BSA Free

TIP60 Antibody Western Blot: TIP60 Antibody [NBP3-25195]

Western Blot: TIP60 Antibody [NBP3-25195]

Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10
Lane 2: RT-4
Lane 3: U-251MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
TIP60 Antibody Immunocytochemistry/Immunofluorescence: TIP60 Antibody [NBP3-25195]

Immunocytochemistry/Immunofluorescence: TIP60 Antibody [NBP3-25195]

Staining of human cell line U2OS shows localization to nucleoplasm & cytosol.
TIP60 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TIP60 Antibody - BSA Free [NBP3-25195]

Chromatin Immunoprecipitation-exo-Seq: TIP60 Antibody - BSA Free [NBP3-25195]

ChIP-Exo-Seq composite graph for Anti-KAT5 (NBP3-25195) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TIP60 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml

Western Blot

0.04-0.4 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIP60

HTATIP (HIV-1 Tat interacting protein TIP60, about 60kDa) belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. The nucleosome, made up of four core histone proteins (H2A, H2B, H3 and H4), is the primary building block of chromatin. In addition to the growing number of post-translational histone modifications regulating chromatin structure, cells can also exchange canonical histones with variant histones that can directly or indirectly modulate chromatin structure. There are five major variants of histone H2A: canonical H2A (most abundant), H2A.X, MacroH2A, H2ABbd and H2A.Z. Histone H2A.Z, the most conserved variant across species, functions as both a positive and negative regulator of transcription and is important for chromosome stability. Several homologous protein complexes, such as SWR-C, TIP60 and SRCAP (mammals), have been shown to catalyze the ATP-dependent exchange of H2A.Z for H2A in the nucleosome. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.

Long Name

Histone acetyltransferase KAT5

Alternate Names

HTATIP, KAT5

Gene Symbol

KAT5

Additional TIP60 Products

Product Documents for TIP60 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIP60 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIP60 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIP60 Antibody - BSA Free and earn rewards!

Have you used TIP60 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...