TIS11D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83655

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TIS11D Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TIS11D. Peptide sequence: MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TIS11D Antibody - BSA Free

Western Blot: TIS11D Antibody [NBP2-83655]

Western Blot: TIS11D Antibody [NBP2-83655]

Western Blot: TIS11D Antibody [NBP2-83655] - WB Suggested Anti-ZFP36L2 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysateZFP36L2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Applications for TIS11D Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIS11D

The TIS11D gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The encoded protein contains a distinguishing putative zinc finger domain with

Alternate Names

HF.10, HF10Zinc finger protein HF.10, Zfp105, zinc finger protein 35, zinc finger protein 35 (clone HF.10)

Gene Symbol

ZFP36L2

Additional TIS11D Products

Product Documents for TIS11D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIS11D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIS11D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIS11D Antibody - BSA Free and earn rewards!

Have you used TIS11D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies