TMED8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85934

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TMED8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMED8. Peptide sequence: EVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TMED8 Antibody - BSA Free

Western Blot: TMED8 Antibody [NBP2-85934]

Western Blot: TMED8 Antibody [NBP2-85934]

Western Blot: TMED8 Antibody [NBP2-85934] - WB Suggested Anti-TMED8 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: THP-1 cell lysate

Applications for TMED8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMED8

TMED8 is a gene that codes for a protein that is 325 amino acids in length and weighs approximately 36 kDa. Current studies are being done on diseases and disorders linked to this gene including lung cancer.

Alternate Names

FAM15B, family with sequence similarity 15, member B, MGC126559, protein TMED8, transmembrane emp24 domain containing 8, transmembrane emp24 protein transport domain containing 8

Gene Symbol

TMED8

Additional TMED8 Products

Product Documents for TMED8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMED8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMED8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMED8 Antibody - BSA Free and earn rewards!

Have you used TMED8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies