TNFAIP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88445

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TNFAIP2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TNFAIP2. Peptide sequence: EAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQGLDG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TNFAIP2 Antibody - BSA Free

Western Blot: TNFAIP2 Antibody [NBP2-88445]

Western Blot: TNFAIP2 Antibody [NBP2-88445]

Western Blot: TNFAIP2 Antibody [NBP2-88445] - Host: Rabbit. Target Name: TNFAIP2. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml

Applications for TNFAIP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TNFAIP2

TNFAIP2 was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. The expression of this gene was shown to be induced by retinoic acid in a cell line expressing a oncogenic version of the retinoic acid receptor alpha fusion protein, which suggested that this gene may be a retinoic acid target gene in acute promyelocytic leukemia.

Alternate Names

B94, EXOC3L3, exocyst complex component 3-like 3, Primary response gene B94 protein, TNF alpha-induced protein 2, tumor necrosis factor alpha-induced protein 2, tumor necrosis factor, alpha-induced protein 2

Gene Symbol

TNFAIP2

Additional TNFAIP2 Products

Product Documents for TNFAIP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TNFAIP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TNFAIP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TNFAIP2 Antibody - BSA Free and earn rewards!

Have you used TNFAIP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies