TNFAIP8L2 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-93009
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TNFAIP8L2 (NP_078851.2). MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for TNFAIP8L2 Antibody - Azide and BSA Free
Western Blot: TNFAIP8L2 AntibodyAzide and BSA Free [NBP2-93009]
Western Blot: TNFAIP8L2 Antibody [NBP2-93009] - Analysis of extracts of various cell lines, using TNFAIP8L2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunoprecipitation: TNFAIP8L2 Antibody - Azide and BSA Free [NBP2-93009]
Immunoprecipitation: TNFAIP8L2 Antibody [NBP2-93009] - Immunoprecipitation analysis of 25ug extracts of Mouse spleen cells using 3ug TNFAIP8L2 antibody (NBP2-93009). Western blot was performed from the immunoprecipitate using TNFAIP8L2 antibody (NBP2-93009) at a dilution of 1:1000.Immunocytochemistry/ Immunofluorescence: TNFAIP8L2 Antibody - Azide and BSA Free [NBP2-93009]
Immunocytochemistry/Immunofluorescence: TNFAIP8L2 Antibody [NBP2-93009] - Analysis of L929 cells using TNFAIP8L2 at dilution of 1:100. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: TNFAIP8L2 Antibody - Azide and BSA Free [NBP2-93009]
Immunocytochemistry/Immunofluorescence: TNFAIP8L2 Antibody [NBP2-93009] - Analysis of HeLa cells using TNFAIP8L2 at dilution of 1:100. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: TNFAIP8L2 Antibody - Azide and BSA Free [NBP2-93009] -
Immunocytochemistry/ Immunofluorescence: TNFAIP8L2 Antibody - Azide and BSA Free [NBP2-93009] - Immunofluorescence analysis of C6 cells using TNFAIP8L2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for TNFAIP8L2 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: TNFAIP8L2
Alternate Names
FLJ23467, Inflammation factor protein 20, TIPE2, TIPE2inflammation factor 20, TNF alpha-induced protein 8-like protein 2, TNFAIP8-like protein 2, tumor necrosis factor alpha-induced protein 8-like protein 2, tumor necrosis factor, alpha-induced protein 8-like 2, tumor necrosis factor, alpha-induced protein 8-like protein 2
Gene Symbol
TNFAIP8L2
Additional TNFAIP8L2 Products
Product Documents for TNFAIP8L2 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TNFAIP8L2 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCustomer Reviews for TNFAIP8L2 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review TNFAIP8L2 Antibody - Azide and BSA Free and earn rewards!
Have you used TNFAIP8L2 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...