TNIP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85963

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TNIP3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TNIP3. Peptide sequence: YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TNIP3 Antibody - BSA Free

Western Blot: TNIP3 Antibody [NBP2-85963]

Western Blot: TNIP3 Antibody [NBP2-85963]

Western Blot: TNIP3 Antibody [NBP2-85963] - WB Suggested Anti-TNIP3 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

Applications for TNIP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TNIP3

TNIP3 binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor,Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibitsNF-kappa-B-dependent gene expression in re

Alternate Names

A20, A20-binding inhibitor of NF-kappa-B activation 3, ABIN3, ABIN-3ABIN-3 beta, FLJ21162, LINDListeria induced, Listeria-induced gene protein, TNFAIP3 interacting protein 3, TNFAIP3-interacting protein 3, TNFAIP3-interacting protein 3 beta, TNIP3 beta

Gene Symbol

TNIP3

Additional TNIP3 Products

Product Documents for TNIP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TNIP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TNIP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TNIP3 Antibody - BSA Free and earn rewards!

Have you used TNIP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies