TNRC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83704

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TNRC4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human TNRC4. Peptide sequence: MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TNRC4 Antibody - BSA Free

Western Blot: TNRC4 Antibody [NBP2-83704]

Western Blot: TNRC4 Antibody [NBP2-83704]

Western Blot: TNRC4 Antibody [NBP2-83704] - WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate

Applications for TNRC4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TNRC4

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. While several transcript variants may exist for this gene, the full-length nature of only one has been biologically validated to date. (provided by RefSeq)

Alternate Names

BRUNOL1CAG repeat protein 4, CAG/CTG 4, CAGH4CUG-BP- and ETR-3-like factor 3, CELF-3, CUGBP, Elav-like family member 3, ERDA4ELAV-type RNA-binding protein 1, ETR-1, MGC57297, TNRC4RNA-binding protein BRUNOL-1

Gene Symbol

CELF3

Additional TNRC4 Products

Product Documents for TNRC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TNRC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TNRC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TNRC4 Antibody - BSA Free and earn rewards!

Have you used TNRC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies