TOMM40L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83707

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TOMM40L Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TOMM40L. Peptide sequence: GGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TOMM40L Antibody - BSA Free

Western Blot: TOMM40L Antibody [NBP2-83707]

Western Blot: TOMM40L Antibody [NBP2-83707]

Western Blot: TOMM40L Antibody [NBP2-83707] - WB Suggested Anti-TOMM40L Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HT1080 cell lysate

Applications for TOMM40L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TOMM40L

Potential channel-forming protein implicated in import of protein precursors into mitochondria Forms part of the preprotein translocase of the outer mitochondrial membrane (TOM complex) containing TOMM22, TOMM40, TOMM40L and TOMM70. Interacts with mitochondrial targeting sequences.

Alternate Names

FLJ12770, mitochondrial import receptor subunit TOM40B, Protein TOMM40-like, TOMM40BRP11-297K8.10, translocase of outer mitochondrial membrane 40 homolog (yeast)-like, translocase of outer mitochondrial membrane 40 homolog-like, translocase of outer mitochondrial membrane 40 homolog-like (yeast)

Gene Symbol

TOMM40L

Additional TOMM40L Products

Product Documents for TOMM40L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TOMM40L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TOMM40L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TOMM40L Antibody - BSA Free and earn rewards!

Have you used TOMM40L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies