TOX3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10590

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all TOX3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TOX3. Peptide sequence MKCQPRSGARRIEERLHYLITTYLKFGNNNNYMNMAEANNAFFAASETFH

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TOX3 Antibody - BSA Free

Western Blot: TOX3 Antibody [NBP3-10590]

Western Blot: TOX3 Antibody [NBP3-10590]

Western Blot: TOX3 Antibody [NBP3-10590] - Western blot analysis of TOX3 in 293T Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for TOX3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TOX3

The protein encoded by the TOX3 gene contains an HMG-box, indicating that it may be involved in bending and unwinding of DNA and alteration of chromatin structure. The C-terminus of the encoded protein is glutamine-rich due to CAG repeats in the coding sequence. A minor allele of this gene has been implicated in an elevated risk of breast cancer. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

CAG trinucleotide repeat-containing gene F9 protein, CAGF9trinucleotide repeat containing 9, TNRC9, TOX high mobility group box family member 3, Trinucleotide repeat-containing gene 9 protein

Gene Symbol

TOX3

Additional TOX3 Products

Product Documents for TOX3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TOX3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TOX3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TOX3 Antibody - BSA Free and earn rewards!

Have you used TOX3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies