TRIM16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56990

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRIM16 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YCKFKNTEDITFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAIVQRKYWTSKPEPST

Reactivity Notes

Mouse 83%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRIM16 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TRIM16 Antibody [NBP2-56990]

Immunocytochemistry/ Immunofluorescence: TRIM16 Antibody [NBP2-56990]

Immunocytochemistry/Immunofluorescence: TRIM16 Antibody [NBP2-56990] - Staining of human cell line A549 shows localization to cytosol.

Applications for TRIM16 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM16

TRIM16 was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined.

Alternate Names

DKFZp434O1826, EBBPtripartite motif-containing 16, Estrogen-responsive B box protein, tripartite motif containing 16, tripartite motif-containing protein 16

Gene Symbol

TRIM16

Additional TRIM16 Products

Product Documents for TRIM16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRIM16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM16 Antibody - BSA Free and earn rewards!

Have you used TRIM16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies