TRIM3/BERP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79699

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRIM3/BERP Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is Trim3. Peptide sequence FFISSLMEAMQQAPEGAHDPEDPHPLSAVAGRPLSCPNHEGKTMEFYCEA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TRIM3/BERP Antibody - BSA Free

Western Blot: TRIM3/BERP Antibody [NBP1-79699]

Western Blot: TRIM3/BERP Antibody [NBP1-79699]

Western Blot: TRIM3/BERP Antibody [NBP1-79699] - Titration: 1.0 ug/ml Positive Control: Mouse Heart.

Applications for TRIM3/BERP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM3/BERP

TRIM3 is encoded by this gene is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. Alternatively spliced transcript variants encoding the same isoform have been identified.

Alternate Names

BERPRING finger protein 97, Brain-expressed RING finger protein, HAC1, RING finger protein 22, RNF22brain expressed ring finger, RNF97FLJ16135, tripartite motif containing 3, tripartite motif protein TRIM3, tripartite motif-containing 3, tripartite motif-containing protein 3

Gene Symbol

TRIM3

UniProt

NP_061368 (Mouse)

Additional TRIM3/BERP Products

Product Documents for TRIM3/BERP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRIM3/BERP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM3/BERP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM3/BERP Antibody - BSA Free and earn rewards!

Have you used TRIM3/BERP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies