TRIM34 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80359

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human TRIM34. Peptide sequence CRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TRIM34 Antibody - BSA Free

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Thymus lysate, concentration 0.2-1 ug/ml.
Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for TRIM34 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM34

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Expression of this gene is up-regulated by interferon. This gene is mappped to chromosome 11p15, where it resides within a TRIM gene cluster. Alternate splicing of this gene generates four transcript variants. Additionally, a read-through transcript transcribed from this gene and TRIM6 has been observed.

Alternate Names

EC 6.3.2, interferon-responsive, Interferon-responsive finger protein 1, RING finger protein 21, RNF21tripartite motif-containing protein 34, tripartite motif containing 34, tripartite motif-containing 34

Gene Symbol

TRIM34

Additional TRIM34 Products

Product Documents for TRIM34 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRIM34 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM34 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM34 Antibody - BSA Free and earn rewards!

Have you used TRIM34 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...