TRIM34 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80359

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRIM34 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human TRIM34. Peptide sequence CRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TRIM34 Antibody - BSA Free

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Thymus lysate, concentration 0.2-1 ug/ml.
Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359]

Western Blot: TRIM34 Antibody [NBP1-80359] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for TRIM34 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM34

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Expression of this gene is up-regulated by interferon. This gene is mappped to chromosome 11p15, where it resides within a TRIM gene cluster. Alternate splicing of this gene generates four transcript variants. Additionally, a read-through transcript transcribed from this gene and TRIM6 has been observed.

Alternate Names

EC 6.3.2, interferon-responsive, Interferon-responsive finger protein 1, RING finger protein 21, RNF21tripartite motif-containing protein 34, tripartite motif containing 34, tripartite motif-containing 34

Gene Symbol

TRIM34

UniProt

NP_569074 (Human)

Additional TRIM34 Products

Product Documents for TRIM34 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRIM34 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM34 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM34 Antibody - BSA Free and earn rewards!

Have you used TRIM34 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies