TRIM49 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55061

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRIM49 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TRIM49(tripartite motif-containing 49) The peptide sequence was selected from the N terminal of TRIM49. Peptide sequence RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TRIM49 Antibody - BSA Free

Western Blot: TRIM49 Antibody [NBP1-55061]

Western Blot: TRIM49 Antibody [NBP1-55061]

Western Blot: TRIM49 Antibody [NBP1-55061] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for TRIM49 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM49

TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This gene has been found to be preferentially expressed in testis.

Alternate Names

RING finger protein 18TRIM49L2, RNF18testis-specific RING Finger protein, Testis-specific RING-finger protein, tripartite motif containing 49, tripartite motif-containing 49, tripartite motif-containing protein 49

Gene Symbol

TRIM49

UniProt

Q9NS80 (Human)

Additional TRIM49 Products

Product Documents for TRIM49 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRIM49 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM49 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM49 Antibody - BSA Free and earn rewards!

Have you used TRIM49 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies