TrkA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38265

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TrkA Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TrkA Antibody - BSA Free

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265]

Immunohistochemistry-Paraffin: TrkA Antibody [NBP2-38265] - Analysis in human adrenal gland and prostate tissues using NBP2-38265 antibody. Corresponding TrkA RNA-seq data are presented for the same tissues.

Applications for TrkA Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TrkA

The Trk proto-oncogene encodes a 140 kDa, membrane-spanning protein tyrosine kinase that is expressed only in neural tissues. Nerve growth factor (NGF) stimulates phosphorylation of Trk A in neural cell lines and in embryonic dorsal root ganglia. Affinity cross-linking and equilibrium binding experiments with 125I-labeled NGF indicate that Trk A binds NGF specifically in cultured cells with a dissociation constant of 10(-9) molar. The identification of Trk A as an NGF receptor indicates that this protein participates in the primary signal transduction mechanism of NGF (1). Trk A was found to be expressed in the nervous system and phosphorylated in response to NGF (Nerve Growth Factor). Somatic rearrangement(s) of the TRKA gene (also designated NTRK1) are responsible for formation of some oncogenes (2). Trk A is expressed in neural and nonneuronal tissues. Like RET, Trk A is often activated by rearrangements that involve one of at least five other genes in papillary thyroid carcinoma (PTC) (3).

Long Name

Neurotrophic Tyrosine Kinase Receptor A

Alternate Names

NTRK-1, NTRK1

Gene Symbol

NTRK1

UniProt

P04629

Additional TrkA Products

Product Documents for TrkA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TrkA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Receptor Tyrosine Kinases (RTKs)

Customer Reviews for TrkA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TrkA Antibody - BSA Free and earn rewards!

Have you used TrkA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TrkA Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am searching (with difficulty) for an antibody against Trka which can be used in flow cytometry. Since I am planning to use it for bead sorting of live cells it needs to be for a part of the receptor which is on the outside of the cell. Please can you let me know if you can help me with this.

    A: NBP1-47436, NB100-98815 and NB100-65266 all bind to the extracellular domain of Trka, however, none of them are guaranteed for use in flow cytometry. Our only flow cytometry guaranteed antibodies bind to the intracellular domain. This does not mean one of these antibodies won't work for flow, we just can not guarantee it. If you would be interested in testing this novel application on one of our Trka antibodies, please take a look at our Innovators Reward Program.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies