Tropomodulin 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56652

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Tropomodulin 3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TMOD3(tropomodulin 3 (ubiquitous)) The peptide sequence was selected from the middle region of TMOD3. Peptide sequence ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tropomodulin 3 Antibody - BSA Free

Western Blot: Tropomodulin 3 Antibody [NBP1-56652]

Western Blot: Tropomodulin 3 Antibody [NBP1-56652]

Western Blot: Tropomodulin 3 Antibody [NBP1-56652] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for Tropomodulin 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tropomodulin 3

TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.

Alternate Names

tropomodulin 3 (ubiquitous), tropomodulin-3, Ubiquitous tropomodulin, UTMOD, U-Tmod

Gene Symbol

TMOD3

UniProt

Q9NYL9 (Human)

Additional Tropomodulin 3 Products

Product Documents for Tropomodulin 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tropomodulin 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tropomodulin 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tropomodulin 3 Antibody - BSA Free and earn rewards!

Have you used Tropomodulin 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies