TRPM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59618

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TRPM2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TRPM2(transient receptor potential cation channel, subfamily M, member 2) The peptide sequence was selected from the N terminal of TRPM2. Peptide sequence VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

171 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TRPM2 Antibody - BSA Free

Western Blot: TRPM2 Antibody [NBP1-59618]

Western Blot: TRPM2 Antibody [NBP1-59618]

Western Blot: TRPM2 Antibody [NBP1-59618] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: TRPM2 Antibody [NBP1-59618]

Immunohistochemistry-Paraffin: TRPM2 Antibody [NBP1-59618]

Immunohistochemistry-Paraffin: TRPM2 Antibody [NBP1-59618] - Human Heart Tissue, 10-20 ug/ml antibody concentration.
Western Blot: TRPM2 Antibody [NBP1-59618]

Western Blot: TRPM2 Antibody [NBP1-59618]

Western Blot: TRPM2 Antibody [NBP1-59618] - Human Fetal Brain Lysate, concentration 1ug/ml.
Immunohistochemistry-Paraffin: TRPM2 Antibody [NBP1-59618]

Immunohistochemistry-Paraffin: TRPM2 Antibody [NBP1-59618]

Immunohistochemistry-Paraffin: TRPM2 Antibody [NBP1-59618] - human LCL and mouse brains incubated for 5 minutes in CDP-Star for 5 minutes tissue.

Applications for TRPM2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Reviewed Applications

Read 2 reviews rated 5 using NBP1-59618 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRPM2

TRPM2 is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death.The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

EC 3.6.1.13, EREG1MGC133383, Estrogen-responsive element-associated gene 1 protein, KNP3LTrpC-2, Long transient receptor potential channel 2, LTrpC2, LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2, NUDT9H, NUDT9L1, transient receptor potential cation channel, subfamily M, member 2, Transient receptor potential channel 7, TrpC7

Gene Symbol

TRPM2

UniProt

O94759 (Human)

Additional TRPM2 Products

Product Documents for TRPM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TRPM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRPM2 Antibody - BSA Free (2)

5 out of 5
2 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used TRPM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: mouse kidney, liver, heart, intewstine, brain and spleen
    Species: Mouse
    Verified Customer | Posted 01/21/2015
    TRPM2 expression in different organs
    TRPM2 Antibody - BSA Free NBP1-59618
  • Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: kidney
    Species: Mouse
    Verified Customer | Posted 01/21/2015
    TRPM2 Immunofluorescence (confocal microscopy)
    TRPM2 Antibody - BSA Free NBP1-59618

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies