TRPV4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82366

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRPV4. Peptide sequence: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TRPV4 Antibody - BSA Free

Western Blot: TRPV4 Antibody [NBP2-82366]

Western Blot: TRPV4 Antibody [NBP2-82366]

Western Blot: TRPV4 Antibody [NBP2-82366] - Host: Rabbit. Target Name: TRPV4. Sample Type: PANC1. Antibody Dilution: 1.0ug/mlTRPV4 is supported by BioGPS gene expression data to be expressed in PANC1
Immunohistochemistry: TRPV4 Antibody [NBP2-82366]

Immunohistochemistry: TRPV4 Antibody [NBP2-82366]

Immunohistochemistry: TRPV4 Antibody [NBP2-82366] - Rat Hippocamus
Western Blot: TRPV4 Antibody [NBP2-82366]

Western Blot: TRPV4 Antibody [NBP2-82366]

Western Blot: TRPV4 Antibody [NBP2-82366] - WB Suggested Anti-TRPV4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HT1080 cell lysate
Western Blot: TRPV4 Antibody [NBP2-82366]

Western Blot: TRPV4 Antibody [NBP2-82366]

Western Blot: TRPV4 Antibody [NBP2-82366] - Host: Rabbit. Target Name: TRPV4. Sample Type: HT1080. Antibody Dilution: 1.0ug/ml
Western Blot: TRPV4 Antibody [NBP2-82366]

Western Blot: TRPV4 Antibody [NBP2-82366]

Western Blot: TRPV4 Antibody [NBP2-82366] - Host: Rabbit. Target Name: TRPV4. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml

Applications for TRPV4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRPV4

TRPV4 is a cation-selective channel, activated in response to systemic osmotic pressure. FUNCTION: Non-selective calcium permanent cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation by exposure to hypotonicity within the physiological range exhibits an outward rectification. Also activated by low pH, citrate and phorbol esters. Increase of intracellular Ca(2+) potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism. SUBUNIT: Interacts with calmodulin. Interacts with Map7 and Src family Tyr protein kinases LYN, SRC, FYN, HCK, LCK and YES. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed lung, spleen, kidney, testis, fat, and at very low levels in trigeminal ganglia. SIMILARITY: Belongs to the transient receptor family, TrpV subfamily. SIMILARITY: Contains 3 ANK repeats.

Long Name

Transient receptor potential cation channel subfamily V member 4

Alternate Names

HMSN2C, OTRPC4, SSQTL1, TRP12, VR-OAC, VRL-2, VRL2, VROAC

Gene Symbol

TRPV4

Additional TRPV4 Products

Product Documents for TRPV4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRPV4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRPV4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRPV4 Antibody - BSA Free and earn rewards!

Have you used TRPV4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...