Tryptophanyl tRNA synthetase Antibody (3B2F10)

Novus Biologicals | Catalog # NBP3-16419

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3B2F10 expressed in HEK293
View all Tryptophanyl tRNA synthetase Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 3-98 of human Tryptophanyl tRNA synthetase (P23381). NSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Tryptophanyl tRNA synthetase Antibody (3B2F10)

Western Blot: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419]

Western Blot: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419]

Western Blot: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419] - Western blot analysis of extracts of various cell lines, using Tryptophanyl tRNA synthetase Rabbit mAb (NBP3-16419) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419]

Immunohistochemistry-Paraffin: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419]

Immunohistochemistry-Paraffin: Tryptophanyl tRNA synthetase Antibody (3B2F10) [NBP3-16419] - Immunohistochemistry of paraffin-embedded human placenta using Tryptophanyl tRNA synthetase Rabbit mAb (NBP3-16419) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for Tryptophanyl tRNA synthetase Antibody (3B2F10)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Tryptophanyl tRNA synthetase

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.

Alternate Names

EC 6.1.1, EC 6.1.1.2, GAMMA-2, hWRS, IFI53, IFP53trpRS, Interferon-induced protein 53, TrpRS, tryptophan tRNA ligase 1, cytoplasmic, Tryptophan--tRNA ligase, tryptophanyl-tRNA synthetase, tryptophanyl-tRNA synthetase, cytoplasmic, WRS

Gene Symbol

WARS1

Additional Tryptophanyl tRNA synthetase Products

Product Documents for Tryptophanyl tRNA synthetase Antibody (3B2F10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tryptophanyl tRNA synthetase Antibody (3B2F10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tryptophanyl tRNA synthetase Antibody (3B2F10)

There are currently no reviews for this product. Be the first to review Tryptophanyl tRNA synthetase Antibody (3B2F10) and earn rewards!

Have you used Tryptophanyl tRNA synthetase Antibody (3B2F10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies