TSC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56083

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV

Reactivity Notes

Mouse 86%, Rat 85%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit TSC2 Antibody - BSA Free (NBP2-56083) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for TSC2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TSC2 Antibody [NBP2-56083]

Immunocytochemistry/ Immunofluorescence: TSC2 Antibody [NBP2-56083]

Immunocytochemistry/Immunofluorescence: TSC2 Antibody [NBP2-56083] - Staining of human cell line HeLa shows localization to cytosol.

Applications for TSC2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSC2

Tuberous sclerosis complex-2 (TCS2 also known as Tuberin) is a tumor suppressor that forms a complex with TSC1 (Hamartin ) and this complex is known to control various cellular functions including cell cycle, endocytosis, adhesion, and transcription (1). The C-terminal region of TSC2 contains a GTPase-activating protein (GAP) domain which interacts with Rap1, Rab5 and Rheb (2). The TSC1/TSC2 complex inhibits phosphorylation of S6kinase and 4E-BP1 through inactivation of mTOR (3). Additionally, binding of 14-3-3 beta to TSC2 at Ser1210 reduce the ability of the complex to inhibit phosphorylation of S6 kinase (4). Phosphorylation by ATK at Ser924 and Thr1518 inactivates TSC2 and disrupts its interaction with TSC1 (5). Tuberous sclerosis (TSC), an autosomal dominant disorder that affects 1 in 6000 individuals, is caused by a mutation in either the TSC1 or TSC2 tumor suppressor gene.

Long Name

Tuberous Sclerosis 2

Alternate Names

LAM, TSC4, Tuberin

Gene Symbol

TSC2

Additional TSC2 Products

Product Documents for TSC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TSC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for TSC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSC2 Antibody - BSA Free and earn rewards!

Have you used TSC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies