TSG-9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70738

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TSG-9 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TUSC1(tumor suppressor candidate 1) The peptide sequence was selected from the middle region of TUSC1. Peptide sequence DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TSG-9 Antibody - BSA Free

Western Blot: TSG-9 Antibody [NBP1-70738]

Western Blot: TSG-9 Antibody [NBP1-70738]

Western Blot: TSG-9 Antibody [NBP1-70738] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for TSG-9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSG-9

Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.

Alternate Names

TSG9, tumor suppressor candidate 1

Gene Symbol

TUSC1

Additional TSG-9 Products

Product Documents for TSG-9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TSG-9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TSG-9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSG-9 Antibody - BSA Free and earn rewards!

Have you used TSG-9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies